Fosfonet

3M™ GoggleGear™ 500 series safety goggles feature a low-profile design with an adjustable strap, indirect ventilation, and 3M™ Scotchgard™ protector anti-fog/anti-scratch coating. Additionally, these goggles are D3 (droplet and splash) and D4 (dust)

3M™ GoggleGear™ 500 series safety goggles feature a low-profile design with an adjustable strap, indirect ventilation, and 3M™ Scotchgard™ protector anti-fog/anti-scratch coating. Additionally, these goggles are D3 (droplet and splash) and D4 (dust)

Immunogen Fibrillin-1 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

IgG receptor FcRn large subunit p51 (UniProt: Q61559 also known as FcRn, IgG Fc fragment receptor transporter alpha chain, Neonatal Fc receptor) is encoded by the Fcgrt (also known as Fcrn) gene (Gene ID: 14132) in murine species. FcRn is a

IgG receptor FcRn large subunit p51 (UniProt: Q61559 also known as FcRn, IgG Fc fragment receptor transporter alpha chain, Neonatal Fc receptor) is encoded by the Fcgrt (also known as Fcrn) gene (Gene ID: 14132) in murine species. FcRn is a

Immunogen Recombinant protein corresponding to formin binding protein 1 Sequence DYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLSLKLGATPEDFSNLPPEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen FOS-like antigen 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen forkhead box O3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen forkhead box O4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Fascin-1 or FSCN1 is an actin binding protein that is induced in mature dendritic cells. FSCN1 is not homologous to other actin-binding proteins and is not expressed in macrophages and neutrophils.

Anti-FSP1/S100A4 100 æg

Immunogen Synthetic peptide directed towards the N terminal of human LASS4 Biochem/physiol Actions LASS4 is a member of LASS family. Members of this family regulate (dihydro)ceramide synthases responsible for production of sphingolipids containing