-
Add to Cart The item has been addedHPA053107-25ULANTI-COL8A1
Price: $540.00List Price: $600.00Collagen type VIII α 1 chain (COL8A1) is one of the two α chains of type VIII collagen, which is involved in angiogenesis and artery remodeling. It is the major component of the Descemet′s membrane of the cornea. -
Add to Cart The item has been addedHPA059297-100ULAnti-ITGB1 (C15-1463-209)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to integrin subunit beta 1 Sequence KANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEP Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA069003-100ULAnti-ITGB1 (C15-1465-584)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to integrin subunit beta 1 Sequence FQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNE Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedABE2586Anti-NR2F2 (ARP-1) isoform B (C15-1317-043)
Price: $666.86List Price: $740.95COUP transcription factor 2 (UniProt: P24468-2 also known as COUP-TF2, COUP-TF II, Apolipoprotein A-I regulatory protein 1, ARP-1, COUP transcription factor II, COUP-TF II, Nuclear receptor subfamily 2 group F member 2) is encoded by the NR2F2 -
Add to Cart The item has been addedAV41311-100ULANTI-WDR13
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human WDR13 Biochem/physiol Actions WDR13 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically -
Add to Cart The item has been added711-1024F(ab')2 Rb IgG F(ab')2 TRITC MX6 500æL
Price: $289.95List Price: $322.16F(ab')2 Anti-Rabbit IgG F(ab')2 Rhodamine Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor -
Add to Cart The item has been addedJ64109-MGAP 27 1mg
Price: $260.40List Price: $289.33Synonym(s): Ser-Arg-Pro-Thr-Glu-Lys-Thr-Ile-Phe-Ile-Ile Formula: C60H102N15O17 Formula weight: 1305.54 CAS Number: 198284-64-9 Harmonized Tariff Code: 2933.99 -
Add to Cart The item has been added611-1904Gt Anti-Rb IgG F(ab')2 Texas Red 2mg
Price: $313.13List Price: $347.92This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor imaging, utilizing various commercial -
Add to Cart The item has been added611-1004Gt Anti-Rb IgG F(ab')2 TRITC 2mg
Price: $315.05List Price: $350.06This product is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor imaging, utilizing various commercial -
Add to Cart The item has been addedA0CB7308-25ZH-AIB-OH, 25GR
Price: $73.80List Price: $82.00Structure confirmed. Purity = 98%. Will ship with Certificate of Analysis (CoA) -
Add to Cart The item has been added70191-100GMueller Hinton Agar (C15-1307-889)
Price: $85.44List Price: $94.94Mueller Hinton Agar is specially designed for antibiotic susceptibility testing using the disc diffusion method (Kirby Bauer method). It has been recommended by the CLSI as the ideal medium for antibiotic susceptibility testing for the following -
Add to Cart The item has been added70191-2.5KGMueller Hinton Agar (C15-1307-890)
Price: $757.68List Price: $841.87Mueller Hinton Agar is specially designed for antibiotic susceptibility testing using the disc diffusion method (Kirby Bauer method). It has been recommended by the CLSI as the ideal medium for antibiotic susceptibility testing for the following
