-
Add to Cart The item has been added1133531-1/2 (Maxi) TC x 1/4 Barb
Price: $228.69List Price: $254.10FlowLinX Sanitary Fittings are designed for single use fluid transfer applications where sanitary processing is critical. They are available in 3/4&rdquo and 1-1/2&rdquo flange sizes and can be easily assembled with silicone and TPE tubing. -
Add to Cart The item has been added407290-500UGAnti-alpha-Interferon Mouse mAb (MMHA-2) (C15-1303-302)
Price: $1,349.14List Price: $1,499.05Purified mouse monoclonal antibody. Recognizes the ~19 kDa human α-interferon (K A 󖐪 9 M -1 ). -
Add to Cart The item has been addedABS1507Anti-Aurora B (C15-1317-717)
Price: $666.86List Price: $740.95Aurora kinase B (UniProt: Q96GD4 also known as EC:2.7. -
Add to Cart The item has been addedAP1145-100UGAnti-IL13RA2 Mouse mAb (2E10) (C15-1319-089)
Price: $809.40List Price: $899.33Purified mouse monoclonal antibody. Recognizes the ~50 kDa IL13RA2 protein. -
Add to Cart The item has been addedHPA049691-100Anti-IL2RG interleukin 2 receptor, gamma, 100ul UN 1687 6.1
Price: $957.50List Price: $1,063.89Anti-IL2RG interleukin 2 receptor, gamma, 100ul UN 1687 6.1 -
Add to Cart The item has been addedHPA049691-25Anti-IL2RG interleukin 2 receptor, gamma, 25ul UN 1687 6.1 P
Price: $718.81List Price: $798.67Anti-IL2RG interleukin 2 receptor, gamma, 25ul UN 1687 6.1 P -
Add to Cart The item has been addedAV50512-100ULANTI-ING1
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the C terminal region of human ING1 Application Anti-ING1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml. -
Add to Cart The item has been addedABE2864Anti-Meis1 (C15-1317-081)
Price: $666.86List Price: $740.95Homeobox protein Meis1 (UniProt: Q60954-1 P97367-2 and P97367-3 also known as Myeloid ecotropic viral integration site 1 (Meis1) and Meis1-related protein 1) is encoded by the Meis1 gene (Gene ID: 17268). Meis proteins act as transcription -
Add to Cart The item has been addedABE2864-25UGAnti-Meis1 (C15-1317-082)
Price: $323.27List Price: $359.18Homeobox protein Meis1 (UniProt: Q60954-1 P97367-2 and P97367-3 also known as Myeloid ecotropic viral integration site 1 (Meis1) and Meis1-related protein 1) is encoded by the Meis1 gene (Gene ID: 17268). Meis proteins act as transcription -
Add to Cart The item has been addedAV36534-100ULANTI-PGBD3
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human PGBD3 Sequence Synthetic peptide located within the following region: NLPGSLLHTAAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPP Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedABE868Anti-PGC-1 alpha (C15-1317-236)
Price: $759.43List Price: $843.81Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (UniProt: O70343 also known as PGC-1-alpha, PPAR-gamma coactivator 1-alpha, PPARGC-1-alpha) is encoded by the Ppargc1a (also known as Pgc1, Pgc1a, Ppargc1) gene (Gene ID: 19017) -
Add to Cart The item has been addedABE868-25UGAnti-PGC-1 alpha (C15-1317-237)
Price: $323.27List Price: $359.18Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (UniProt: O70343 also known as PGC-1-alpha, PPAR-gamma coactivator 1-alpha, PPARGC-1-alpha) is encoded by the Ppargc1a (also known as Pgc1, Pgc1a, Ppargc1) gene (Gene ID: 19017)
