Ritonavir

LiChrosolv &#174 solvents show high degree of UV transmittance, low particle count, low acidity and alkalinity and low evaporation residue level. This makes them suitable for reproducible separations.

LiChrosolv &#174 solvents show high degree of UV transmittance, low particle count, low acidity and alkalinity and low evaporation residue level. This makes them suitable for reproducible separations.

Cell Line Origin Mouse, AKR, embryo Cell Line Description This cell line has the capacity to be activated to produce murine leukaemia virus (MLV). Mice of the high leukaemic inbred strain AKR regularly contain high levels of MLV throughout most of

Immunogen Recombinant protein corresponding to regulator of G-protein signaling 19 Sequence PHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Recombinant protein corresponding to regulator of G-protein signaling 19 Sequence QPLPSCEVCATPSPEEVQSWAQSFDKL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

The emission spectra for this ATTO conjugate matches the principle output wavelengths of most common fluorescence instrumentation.

SYSTAAQ Parvovirus B19 Real Time PCR Kit is an in vitro nucleic acid amplification system used for the Qualitative detection of Parvovirus B19 specific DNA in the human EDTA plasma in Real Time PCR. SYSTAAQ Parvovirus B19 Real Time PCR Kits use an

PrEST Antigen ARHGAP1 Rho GTPase activating protein 1, 100ul

PrEST Antigen ARHGAP19 Rho GTPase activating protein 19, 100

PrEST Antigen ARHGAP21 Rho GTPase activating protein 21, 100

PrEST Antigen ARHGAP21 Rho GTPase activating protein 21, 100

PrEST Antigen ARHGAP23 Rho GTPase activating protein 23, 100