Central nervous system drugs

8-Anilino-1-naphthalene Sulfonic Acid is a hydrophobic polarity sensitive fluorescent dye useful as a site probe to detect conformational changes in cell and micelle membranes and molecules such as proteins. ANSA is also used as a fluorescent probe

Multifunctional protein ADE2, which is encoded by the gene name PAICS, ADE2, AIRC, PAIS, is a member of the SAICAR synthetase family and the AIR carboxylase family. Multifunctional protein ADE2 includes the following two domains:

Immunogen adhesion G protein-coupled receptor A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen adhesion G protein-coupled receptor A2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

GPR125 (G protein-coupled receptor 125) is a candidate marker for human spermatogonial stem cells (SSCs). It is expressed in adult mice testis and is found in long-term pre-pubertal testicular cell cultures that contain SSCs.

Immunogen adhesion G protein-coupled receptor E3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen adhesion G protein-coupled receptor E5 Application Anti-CD97 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against

The gene ADHFE1 (alcohol dehydrogenase, iron containing 1) is mapped to human chromosome 8q13. Immunogen Hydroxyacid-oxoacid transhydrogenase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige

Immunogen Recombinant protein corresponding to adenosine A2a receptor Sequence PERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen albumin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Immunogen albumin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Immunogen aldehyde dehydrogenase 1 family, member L2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a