-
HPA059282-100UL
Anti-ALDH1L2 antibody produced in rabbit (C15-1463-203)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to aldehyde dehydrogenase 1 family member L2 Sequence KCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKT Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
HPA051065-100UL
Anti-ALDH2 antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen aldehyde dehydrogenase 2 family (mitochondrial) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA051150-100UL
Anti-ALDH3A1 antibody produced in rabbit (C15-1460-545)
Price: $928.29List Price: $1,031.43Immunogen aldehyde dehydrogenase 3 family, member A1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA063783-100UL
Anti-ALDH3A1 antibody produced in rabbit (C15-1464-484)
Price: $928.29List Price: $1,031.43Immunogen aldehyde dehydrogenase 3 family, member A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA023296-100UL
Anti-ALDH7A1 antibody produced in rabbit (C15-1450-336)
Price: $879.43List Price: $977.14The gene ALDH7A1 (aldehyde dehydrogenase 7 family member A1) is mapped to human chromosome 5q31. It is present in the cytoplasm and mitochondria. -
HPA053675-100UL
ANTI-ALDH7A1 ANTIBODY PRODUCED IN RABBIT (C15-1461-415)
Price: $977.14List Price: $1,085.71Immunogen aldehyde dehydrogenase 7 family member A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA010873-100UL
Anti-ALDH9A1 antibody produced in rabbit
Price: $879.43List Price: $977.14ALDH9A1 (aldehyde dehydrogenase 9 family, member A1) gene encodes an aldehyde dehydrogenase isozyme. This gene maps to human chromosome 1q22-q23, and spans 45kb consisting of 10 exons. -
HPA003076-100UL
Anti-ALG12 antibody produced in rabbit (C15-1445-775)
Price: $879.43List Price: $977.14Immunogen ALG12, alpha-1,6-mannosyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA051665-100UL
Anti-ALG12 antibody produced in rabbit (C15-1460-745)
Price: $928.29List Price: $1,031.43Immunogen asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
HPA041512-100UL
Anti-ALG2 antibody produced in rabbit (C15-1456-743)
Price: $928.29List Price: $1,031.43Immunogen asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA041601-100UL
Anti-ALG2 antibody produced in rabbit (C15-1456-787)
Price: $928.29List Price: $1,031.43Immunogen asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA007989-100UL
Anti-ALG5 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Dolichyl-phosphate β-glucosyltransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a