Drugs affecting the ears & eye & nose and skin

Immunogen Orthopedia homeobox Physical form Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.

Immunogen Orthopedia homeobox Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to orthopedia homeobox Sequence GRQQAMAQSLSQCSLAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVSGSPQLCSSPDSSDVWRGTSIASLRRKALEHTVSMSFT Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen OTU deubiquitinase, ubiquitin aldehyde binding 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

OTU deubiquitinase, ubiquitin aldehyde binding 2 (OTUB2) is a 29kDa, cysteine protease belonging to the OTU (ovarian tumour) superfamily of proteins. It has two isoforms namely otubain 1 and otubain 2.

Immunogen OTU deubiquitinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

The gene OTUD1 (OTU deubiquitinase 1) is mapped to human chromosome 10p12. The encoded protein has a ubiquitin-interacting motif at the carboxyl terminus.

Immunogen OTU deubiquitinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

OTU deubiquitinase 5 (OTUD5), also known as DUBA (deubiquitinating enzyme A), is a member of 14 DUBs subfamily. The protein is characterized by an ovarian tumor (OTU) domain.

Immunogen OTU deubiquitinase 7A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Ovarian tumor (OTU) deubiquitinase with linear linkage specificity (OTULIN) is a deubiquitinase enzyme. The gene is located on human chromosome 5p15.

Immunogen orthodenticle homeobox 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported