Ecraprost

Immunogen enoyl CoA hydratase domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to ethylmalonyl-CoA decarboxylase 1 Sequence SGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Enoyl-CoA hydratase domain-containing protein 2, mitochondrial Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen enoyl CoA hydratase domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen extracellular matrix protein 2, female organ and adipocyte specific recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen epithelial cell transforming 2 like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Consanguineous: No Homozygous: No Cell Line Description This cell line is an Epstein-Barr Virus (EBV) transformed lymphoblastoid line and is part of the Human Leukocyte Antigen (HLA) Typed Collection maintained by the European Collection of Cell

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

Other Notes Stabilizer for enzymes and biological macromolecules