Epoetin alfa

1,2-Epoxyhexane

1,2-Epoxyhexane

Other Notes Please note that Sigma-Aldrich provides this product to early discovery researchers as part of a collection of unique chemicals. Sigma-Aldrich does not collect analytical data for this product.

Immunogen Recombinant protein corresponding to EGF like domain multiple 7 Sequence RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD Application All Prestige Antibodies Powered by Atlas Antibodies are

Anti-EPN2 epsin 2, 25ul UN 1687 6.1 PG2

Avidin is a basic glycoprotein consisting of four essentially identical subunits. The combined molecular weight of the subunits is about 66,000.

Avidin is a basic glycoprotein consisting of four essentially identical subunits. The combined molecular weight of the subunits is about 66,000.

Avidin is a basic glycoprotein consisting of four essentially identical subunits. The combined molecular weight of the subunits is about 66,000.

Avidin is a basic glycoprotein consisting of four essentially identical subunits. The combined molecular weight of the subunits is about 66,000.

Avidin is a basic glycoprotein isolated from raw egg white. It exhibits high binding affinity for biotin and is capable of producing biotin deficiency in rats and chicks.

Avidin is a basic glycoprotein isolated from raw egg white. It exhibits high binding affinity for biotin and is capable of producing biotin deficiency in rats and chicks.

Avidin is a basic glycoprotein isolated from raw egg white. It exhibits high binding affinity for biotin and is capable of producing biotin deficiency in rats and chicks.