-
Add to Cart The item has been added63445-1LAlmond oil from Prunus dulcis (C15-1283-297)
Price: $358.16List Price: $397.96Almond oil from Prunus dulcis -
Add to Cart The item has been added63445-250MLAlmond oil from Prunus dulcis (C15-1283-298)
Price: $137.92List Price: $153.25Almond oil from Prunus dulcis -
Add to Cart The item has been addedHPA004824-25ULANTI-H6PD
Price: $540.00List Price: $600.00Immunogen GDH/6PGL endoplasmic bifunctional protein precursor [Includes: Glucose 1-dehydrogenase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedAV39504-100ULAnti-PRDM12 antibody produced in rabbit (C15-1341-167)
Price: $759.43List Price: $843.81PR domain proteins (PRDM) are a small family of kruppel-like zinc finger transcription factors involved in cell differentiation and tumorigenesis. PR domain containing 12 (PRDM12) is a putative tumor suppressor that may be implicated in poor -
Add to Cart The item has been addedHPA043143-100ULAnti-PRDM12 antibody produced in rabbit (C15-1457-545)
Price: $928.29List Price: $1,031.43Immunogen PR domain containing 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA077250-100ULAnti-PRR18
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to proline rich 18 Sequence CPDSAARFSLNLTPEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLPAR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA014447-100ULAnti-PRRT2 antibody produced in rabbit (C15-1448-139)
Price: $977.14List Price: $1,085.71Immunogen Proline-rich transmembrane protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA019203-100ULAnti-PRRT2 antibody produced in rabbit (C15-1449-254)
Price: $879.43List Price: $977.14Immunogen proline-rich transmembrane protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA048045-100ULANTI-PRRT2 ANTIBODY PRODUCED IN RABBIT (C15-1459-414)
Price: $977.14List Price: $1,085.71Immunogen proline rich transmembrane protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA035127-100ULAnti-PRRT3 antibody produced in rabbit (C15-1453-710)
Price: $928.29List Price: $1,031.43Immunogen proline-rich transmembrane protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA035128-100ULAnti-PRRT3 antibody produced in rabbit (C15-1453-711)
Price: $928.29List Price: $1,031.43Immunogen proline-rich transmembrane protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA069859-100ULANTI-PRRT3 ANTIBODY PRODUCED IN RABBIT (C15-1465-770)
Price: $977.14List Price: $1,085.71Immunogen proline rich transmembrane protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
