Immunomodulating drugs

Immunogen B-cell CLL/lymphoma 11B (zinc finger protein) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

BCL2 is an apoptotic inhibitor that suppresses lipid peroxidation. Rabbit Anti-BCL2 antibody binds to human BCL2.

Immunogen B-cell CLL/lymphoma 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Bcl-2-related protein A1 (BCL2A1), also known as protein BFL-1, protein GRS, and Bcl-2-like protein 5 (Bcl2-L-5), is a member of the Bcl-2 family. BCL2A1/BFL-1 can interact with Bax and suppress apoptosis by inhibiting the release of cytochrome c

BCL2L1 is a signaling molecule that is known to regulate neuronal apoptosis. Furthermore, BCL2L1 can facilitate the survival of retinal ganglion cells.

BCL2L1 is a signaling molecule that is known to regulate neuronal apoptosis. Furthermore, BCL2L1 can facilitate the survival of retinal ganglion cells.

Immunogen BCL2-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen B-cell CLL/lymphoma 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

BCL6 (B-cell CLL/lymphoma 6) is a nuclear protein, belonging to the BTB/POZ (BR-C, ttk and bab/Pox virus and Zinc finger) domain family of transcription factors. This zinc finger transcription factor has a molecular mass of 95kDa.

Immunogen B-cell CLL/lymphoma 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen B-cell CLL/lymphoma 6, member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to B-cell CLL/lymphoma 6B Sequence YLQMEHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)