Immunomodulating drugs

Immunogen beta-carotene oxygenase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen beta-carotene oxygenase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen BCL6 corepressor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Recombinant protein corresponding to BCL6 corepressor Sequence LRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPG Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen BCL6 corepressor-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen BCL6 corepressor-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen breakpoint cluster region recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen BCS1-like ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen BCS1-like ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Anti-BDNF, mouse monoclonal, clone 35928.11, recognizes the ~20 kDa BDNF protein in brain extracts.

&#946-catenin is the founding member of the &#946 -catenin family. This protein is comprised of 12 ARM repeats and is considered to have dual function depending on its localization.

Catenin are distinct peripheral cytosolic proteins and are classified into &#945-, &#946- and &#947-catenin (102 kDa, 94 kDa and 86 kDa respectively. It is found in varying abundance in many developing and adult tissues.