Immunomodulating drugs

Immunogen basic helix-loop-helix family, member e22 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen basic helix-loop-helix family, member e40 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Class E basic helix-loop-helix protein 40 (UniProt O14503 also known as Basic helix-loop-helix domain containing class B2, Class B basic helix-loop-helix protein 2, Differentially expressed in chondrocytes 1, Differentially expressed in

Immunogen basic helix-loop-helix family, member e41 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen basic helix-loop-helix family member e41 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen betaine--homocysteine S-methyltransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen betaine--homocysteine S-methyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen betaine--homocysteine S-methyltransferase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Bid, a BH3 domain-containing proapoptotic Bcl-2 family member, is known to interact with Bcl-2 and Bax. It has been reported that Bid induces cytochrome c release from mitochondria following cleavage by caspase-8 in response to apoptotic stimuli

Biliverdin reductase A (BVRA) contains a domain that acts as a serine/ threonine/ tyrosine kinase and belongs to the insulin receptor substrate family. Whereas most tyrosine kinase activity is membrane-bound, BVR is a soluble protein.

Bim (bcl-2-interacting mediator of cell death) is a proapoptotic member of the Bcl-2 family that shares only the BH3 domain with this family. There are three isoforms of Bim: Bim EL , Bim L , and Bim S .

Immunogen Myc box-dependent-interacting protein 1 recombinant protein epitope signature tag (PrEST) Sequence SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP Application All Prestige