Immunomodulating drugs

Bridging integrator-1 (BIN1), also called amphiphysin II, is a nucleocytoplasmic protein which is ubiquitously expressed. It is a ligand to the transcription factor Myc and also interacts with SRC SH3, which is a tyrosine kinase ligand.

Immunogen bridging integrator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen bridging integrator 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Bridging integrator 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Livin, also known as &#8220baculoviral IAP repeat-containing protein 7&#8221 (Birc7) and KIAP," is a member of the IAP (inhibitors of apoptosis) family of proteins characterized by highly conserved baculoviral IAP repeats (BIR). In addition,"

Immunogen B-cell acute lymphoblastic leukemia expressed recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen bladder cancer associated protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Recombinant protein corresponding to BLK proto-oncogene, Src family tyrosine kinase Sequence YTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLEMERWF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Bloom syndrome protein (BLM) is a DNA helicase belonging to the RecQ family, having 1417 amino acids. The gene encoding it is present on chromosome 15.

Bleomycin hydrolase (BLMH) is an enzyme that is excreted by the kidneys. It is a neutral cysteine protease expressed at high levels in the skin.

Immunogen bleomycin hydrolase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Bcl-2-modifying factor (Bmf) is a member of the Bcl-2 family containing one BCL2 homology domain 3. Members of this family are critical regulators of apoptosis by either inhibiting or promoting cell death.