Immunomodulating drugs

Bone morphogenetic protein 15 (BMP15), also known as Growth/differentiation factor 9B (GDF9B), is part of the transforming growth factor-beta (TGF-&#946) superfamily. BMP15 is an oocyte-specific growth and differentiation factor that stimulates

Immunogen bone morphogenetic protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

BMP2 inducible kinase (BMP2K) is a putative serine/threonine protein kinase with a nuclear localization signal and a glutamine-rich region. It has a molecular weight of 126kDa.

BMP2 inducible kinase (BMP2K) is a putative serine/threonine protein kinase with a nuclear localization signal and a glutamine-rich region. It has a molecular weight of 126kDa.

BMP2 inducible kinase (BMP2K) is a putative serine/threonine protein kinase with a nuclear localization signal and a glutamine-rich region. It has a molecular weight of 126kDa.

Immunogen bone morphogenetic protein 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Cytoplasmic tyrosine-protein kinase BMX is an enzyme encoded by the BMX gene in humans and is a member of the TEC kinase family. It is expressed in hematopoietic cells of the myeloid lineage, where it participates in the immune response.

Immunogen Immunogen Sequence: GI # 5031617 , sequence 21-210 Recombinant zinc finger protein 256 bone marrow zinc finger 3 Physical form Solution in phosphate buffered saline containing 0.02% sodium azide.

Immunogen basonuclin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen basonuclin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to basonuclin 1 Sequence EKEAVEIANEKRHNLSSDEDMPLQVVSEDEQEACSPQSHRVSEEQHVQSGGLGKPFPEGERPCHRESVIESSG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

The gene basonuclin-2 (BNC2) is mapped to human chromosome 9p22. It belongs to basonuclin zinc-finger family of transcription factors.