-
Add to Cart The item has been addedHPA059419-100ULAnti-BNC2 antibody produced in rabbit (C15-1463-252)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to basonuclin 2 Sequence STQNEYNESSESEVSPTPYKNDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLTKTEHPKSSFRIHRMRRMGSASRKGRVFCNA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA008009-100ULAnti-BNIP1 antibody produced in rabbit (C15-1447-033)
Price: $879.43List Price: $977.14Immunogen Vesicle transport protein SEC20 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA008149-100ULAnti-BNIP1 antibody produced in rabbit (C15-1447-061)
Price: $879.43List Price: $977.14Immunogen BCL2/adenovirus E1B 19kDa interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA026843-100ULAnti-BNIP2 antibody produced in rabbit
Price: $879.43List Price: $977.14BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 (BNIP2) contains protein–protein interaction domain, the BNIP-2 and Cdc42GAP homology (BCH) domain, in the C-terminus. Endogenous BNIP-2 is expressed in Golgi apparatus, early and recycling -
Add to Cart The item has been addedHPA003015-100ULAnti-BNIP3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedB7931-.2MLAnti-BNIP3 antibody, Mouse monoclonal
Price: $987.43List Price: $1,097.14Monoclonal Anti-BNIP3 (mouse IgG2b isotype) is derived from the ANa40 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from BALB/c mouse immunized with a recombinant human BNIP3. B-cell lymphoma 2 (BCL2) Interacting Protein 3 -
Add to Cart The item has been addedHPA015652-100ULAnti-BNIP3L antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like recombinant protein epitope signature tag (PrEST) Application Anti-BNIP3L antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein -
Add to Cart The item has been addedHPA019946-100ULAnti-BNIPL antibody produced in rabbit
Price: $879.43List Price: $977.14BNIPL (BCL2/adenovirus E1B 19kD interacting protein like) is a novel proapoptotic protein belonging to the BNIPL family. It consists of a BNIP-2 and Cdc42GAP homology (BCH) domain. -
Add to Cart The item has been addedHPA060778-100ULAnti-BOC antibody produced in rabbit (C15-1463-621)
Price: $928.29List Price: $1,031.43Immunogen BOC cell adhesion associated, oncogene regulated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA061787-100ULAnti-BOC antibody produced in rabbit (C15-1463-907)
Price: $928.29List Price: $1,031.43Immunogen BOC cell adhesion associated, oncogene regulated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA007005-100ULAnti-BOLA1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen BolA-like protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA046393-100ULANTI-BOLA3 ANTIBODY PRODUCED IN RABBIT (C15-1458-837)
Price: $977.14List Price: $1,085.71Immunogen bolA family member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
