-
Add to Cart The item has been addedHPA028735-100ULAnti-BPGM antibody produced in rabbit (C15-1451-985)
Price: $879.43List Price: $977.14Immunogen 2,3-bisphosphoglycerate mutase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA036752-100ULAnti-BPHL antibody produced in rabbit (C15-1454-526)
Price: $928.29List Price: $1,031.43Immunogen biphenyl hydrolase-like (serine hydrolase) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA036753-100ULAnti-BPHL antibody produced in rabbit (C15-1454-527)
Price: $928.29List Price: $1,031.43Immunogen biphenyl hydrolase-like (serine hydrolase) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA024256-100ULAnti-BPIFB1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Long palate, lung and nasal epithelium carcinoma-associated protein 1 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA049491-100ULAnti-BPIFB2 antibody produced in rabbit (C15-1459-977)
Price: $928.29List Price: $1,031.43Immunogen BPI fold containing family B, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA060121-100ULAnti-BPIFB2 antibody produced in rabbit (C15-1463-457)
Price: $928.29List Price: $1,031.43Immunogen BPI fold containing family B, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA045741-100ULAnti-BPIFB3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen BPI fold containing family B, member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA037665-100ULAnti-BPIFC antibody produced in rabbit (C15-1454-832)
Price: $928.29List Price: $1,031.43Immunogen bactericidal/permeability-increasing protein-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA043306-100ULAnti-BPIFC antibody produced in rabbit (C15-1457-625)
Price: $928.29List Price: $1,031.43Immunogen BPI fold containing family C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedB8436-100UGAnti-Brachyury antibody produced in rabbit
Price: $589.71List Price: $655.24Brachyury (T) is an oncogene mapped to human chromosome 6q27. This gene codes for Brachyury, which is expressed throughout the primary mesoderm during the early stages of embryogenesis. -
Add to Cart The item has been addedAB9125Anti-Brain-Specific Angiogenesis Inhibitor 3 Antibody (C15-1316-471)
Price: $1,011.43List Price: $1,123.81Specificity Recognizes Brain-specific Angiogenesis Inhibitor 3 [BAI3]. Immunogen KLH conjugated synthetic peptide from the 3rd cytoplasmic domain of human BAI3. -
Add to Cart The item has been addedHPA057371-100ULAnti-BRCA1
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to BRCA1, DNA repair associated Sequence GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and
