Immunomodulating drugs

Anti-Calreticulin (405-417), rabbit polyclonal, recognizes the ~63 kDa calreticulin in heat-shocked HeLa cells. It is validated for WB, ICC, IHC, and IP.

The gene for calreticulin (CALR) is located on the human chromosome 19p13.13.

Calreticulin (UniProt P27797 also known as Calregulin, CRP55, CRT, Endoplasmic reticulum resident protein 60, ERp60, grp60, HACBP) is encoded by the CALR (also known as CRTC) gene (Gene ID 811) in human. Calreticulin (CRT), BiP (GRP78 or heat

Anti-Calreticulin, mouse monoclonal, clone FMC75, recognizes the ~63 kDa calreticulin in Molt 4, MCF-7, HeLa, K562, A431 &amp other cells. It is validated for FC, WB, ICC, IHC, and in enzyme immunoassay.

Calsequestrin is expected to modulate ryanodine receptor (RyR) signaling and Ca 2+ release with the help of triadin and junction proteins. Immunogen synthetic peptide corresponding to amino acids 66-84 located near the N-terminus of mouse

Immunogen calcium modulating ligand Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen calcium modulating ligand Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen cullin-associated and neddylation-dissociated 2 (putative) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Protein capicua homolog (CIC) , also known as Capicua Transcriptional Repressor, Capicua Homolog, and encoded by the gene CIC, is a transcriptional repressor which plays a role in development of the central nervous system (CNS). CIC is a new

Immunogen Calpain-2 catalytic subunit Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen calpain 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to calpain small subunit 2 Sequence KWQCVYKQYDRDHSGSLGSSQLRGALQAAGFQLNEQLYQMIVRRYANEDGD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein