Immunomodulating drugs

CAPS-2 and the related protein CAPS-1 encode novel neural/endocrine-specific cytosolic and peripheral membrane proteins. Both are essential components of the synaptic vesicle priming machinery and are required for the Ca2+-regulated exocytosis of

Immunogen calcyphosine-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen calcyphosine-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen F-actin-capping protein subunit alpha-2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen capping protein (actin filament) muscle Z-line, alpha 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen capping protein (actin filament) muscle Z-line, alpha 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

CAPZB (capping actin protein of muscle Z-line &#946 subunit) gene is mapped to human chromosome 1p36.13.

Immunogen capping protein (actin filament) muscle Z-line, beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen CART prepropeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

CRISPR-associated endonuclease Cas9 (UniProt: J7RUA5 also known as SaCas9, Cas9) is encoded by the Cas9 gene in Streptococcus aureus. Cas9 belongs to subtype II-A subfamily with one HNH Cas9-type domain.

CRISPR-associated endonuclease Cas9 (UniProt: J7RUA5 also known as SaCas9, Cas9) is encoded by the Cas9 gene in Streptococcus aureus. Cas9 belongs to subtype II-A subfamily with one HNH Cas9-type domain.

Immunogen Recombinant protein corresponding to CASK interacting protein 2 Sequence APWAFSYLAGPPATPPDPPRPKRRSHSLSRPGPTEGDAEGEAEGPVGSTLGSYATLTRRPGRSALVRTSPSVTPTPARGTPRSQSFALR Application All Prestige Antibodies Powered by Atlas Antibodies are