Immunomodulating drugs

Immunogen CCAAT/enhancer binding protein (C/EBP), delta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen CCAAT/enhancer-binding protein epsilon recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Synthetic peptide directed towards the N terminal region of human CEBPG Biochem/physiol Actions CCAAT/enhancer binding protein (C/EBP), &#947 (CEBPG) is a transcription factor that regulates transcription mediated by CCAAT/enhancer

Immunogen CCAAT/enhancer-binding protein gamma recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Synthetic peptide directed towards the N terminal region of human CEBPZ Sequence Synthetic peptide located within the following region: MAAVKEPLEFHAKRPWRPEEAVEDPDEEDEDNTSEAENGFSLEEVLRLGG Physical form Purified antibody supplied in 1x PBS

Immunogen CCAAT/enhancer binding protein (C/EBP), zeta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

CECR1 (cat eye syndrome chromosome region, candidate 1) gene encodes a member of the family of adenosine deaminase growth factors (ADGFs) that have sequence similarity with classical adenosine deaminase (ADA) at the C-terminus. CECR1 is mainly

Immunogen Cat eye syndrome critical region protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen carboxyl ester lipase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen CUGBP, Elav-like family member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen CUGBP, Elav-like family member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen trinucleotide repeat containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are