Immunomodulating drugs

CHCHD10 (coiled-coil-helix-coiled-coil-helix domain containing 10) gene is also known as IMMD, SMAJ, FTDALS2, N27C7-4 and C22orf16. It encodes a coiled-coil helix mitochondrial protein localized in the intermembrane space and enriched at cristae

Immunogen coiled-coil-helix-coiled-coil-helix domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen coiled-coil-helix-coiled-coil-helix domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen coiled-coil-helix-coiled-coil-helix domain containing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen coiled-coil-helix-coiled-coil-helix domain containing 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Chromodomain-helicase-DNA-binding protein 3, more commonly known as CHD-3, is a member of the CHD family of proteins. These proteins are characterized by the presence of chromo (chromatin organization modifier) domain, SNF2-related helicase/ATPase

Immunogen Chromodomain-helicase-DNA-binding protein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Chromodomain-helicase-DNA-binding protein 7 (CHD7), also known as ATP-dependent helicase CHD7, belongs to a superfamily of proteins of the ATP-dependent chromatin remodeling enzymes that have a unique combination of functional domains, including

Immunogen chromodomain helicase DNA binding protein 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to checkpoint with forkhead and ring finger domains Sequence AYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDISQPYVVCRQCPEYRR Application All Prestige Antibodies Powered by Atlas Antibodies

The product binds to chicken IgY (IgG). Application Anti-Chicken IgY (IgG) (whole molecule) antibody produced in rabbit has been used in enzyme linked immuno sorbent assay (ELISA).

Chicken IgG (immunoglobulin G) is also referred to as IgY. IgY shows similarity to mammalian IgG, differing by the presence of one more constant region domain and absence of functional hinge regions.