-
Add to Cart The item has been addedC1036-2MLAnti-Chicken Serum antibody produced in rabbit
Price: $293.88List Price: $326.53Specificity Strong reactivity with normal chicken serum has been determined by immunoelectrophoresis (IEP). This antiserum has not been assayed for interspecies cross reactivity. -
Add to Cart The item has been addedHPA035069-100ULAnti-CHMP2B antibody produced in rabbit (C15-1453-674)
Price: $928.29List Price: $1,031.43Immunogen chromatin modifying protein 2B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA052754-100ULAnti-CHMP2B antibody produced in rabbit (C15-1461-126)
Price: $928.29List Price: $1,031.43Immunogen charged multivesicular body protein 2B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA015673-100ULAnti-CHMP3 antibody produced in rabbit (C15-1448-420)
Price: $879.43List Price: $977.14Immunogen RING finger protein 103 (Zinc finger protein 103 homolog) (Zfp-103) (KF-1) (hKF-1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA073383-100ULAnti-CHMP3 antibody produced in rabbit (C15-1466-364)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to charged multivesicular body protein 3 Sequence VNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRSRKA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedHPA068473-100ULAnti-CHMP4A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen charged multivesicular body protein 4A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA017282-100ULAnti-CHODL antibody produced in rabbit (C15-1448-719)
Price: $879.43List Price: $977.14Immunogen Chondrolectin precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA057559-100ULANTI-CHODL ANTIBODY PRODUCED IN RABBIT (C15-1462-692)
Price: $977.14List Price: $1,085.71Immunogen chondrolectin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedC8534-1MLAnti-Chorionic Gonadotropin (alpha+beta subunits) (HCG) antibody produced in rabbit
Price: $984.00List Price: $1,093.33Human Chorionic Gonadotropin (HCG) is a hormone detected in the blood and urine during pregnancy. The peak levels of HCG are detected around Week 12 of gestation and diminish during remaining period of pregnancy. -
Add to Cart The item has been addedHPA035123-100ULAnti-CHPF antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chondroitin polymerizing factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA020992-100ULAnti-CHPF2 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene CHPF2 (chondroitin polymerizing factor 2) is mapped to human chromosome 7q36.1-q36. -
Add to Cart The item has been addedHPA059008-100ULAnti-CHRAC1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromatin accessibility complex 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
