-
Add to Cart The item has been addedHPA007191-100ULAnti-CYTIP antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Cytohesin-interacting protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedAB10320Anti-Cytochrome P450 1B1 Antibody (C15-1315-634)
Price: $896.57List Price: $996.19Cytochrome P450 1B1 (CYP1B1) is active in the metabolism of estrogens to reactive catechols and of different procarcinogens. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and the synthesis -
Add to Cart The item has been addedABS1605Anti-Cytochrome p450 2J Family Antibody (C15-1317-740)
Price: $713.14List Price: $792.38Cytochrome P450 2J2 (EC 1.14. -
Add to Cart The item has been addedHPA056216-100ULAnti-D2HGDH antibody produced in rabbit (C15-1462-278)
Price: $977.14List Price: $1,085.71Immunogen D-2-hydroxyglutarate dehydrogenase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA060548-100ULAnti-D2HGDH antibody produced in rabbit (C15-1463-574)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to D-2-hydroxyglutarate dehydrogenase Sequence VTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVS Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA026605-100ULAnti-DAAM1 antibody produced in rabbit (C15-1451-123)
Price: $879.43List Price: $977.14Immunogen Disheveled-associated activator of morphogenesis 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA064789-100ULAnti-DAAM1 antibody produced in rabbit (C15-1464-731)
Price: $928.29List Price: $1,031.43Immunogen dishevelled associated activator of morphogenesis 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA051300-100ULAnti-DAAM2 antibody produced in rabbit (C15-1460-611)
Price: $928.29List Price: $1,031.43Immunogen dishevelled associated activator of morphogenesis 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA054630-100ULAnti-DAAM2 antibody produced in rabbit (C15-1461-741)
Price: $928.29List Price: $1,031.43Immunogen dishevelled associated activator of morphogenesis 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAB5840-IAnti-Dab1 (C15-1316-372)
Price: $759.43List Price: $843.81Disabled homolog 1 (UniProt: P97318 also known as DAB1) is encoded by the Dab1 gene (Gene ID: 13131) in murine species. Dab 1 is mainly expressed in the brain and serves as an adapter molecule involved in neural development where it is reported to -
Add to Cart The item has been addedAB5840-I-25UGAnti-Dab1 (C15-1316-373)
Price: $323.27List Price: $359.18Disabled homolog 1 (UniProt: P97318 also known as DAB1) is encoded by the Dab1 gene (Gene ID: 13131) in murine species. Dab 1 is mainly expressed in the brain and serves as an adapter molecule involved in neural development where it is reported to -
Add to Cart The item has been addedHPA052033-100ULAnti-DAB1 antibody produced in rabbit (C15-1460-884)
Price: $928.29List Price: $1,031.43Immunogen Dab, reelin signal transducer, homolog 1 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
