-
HPA045626-100UL
Anti-DEFB107A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen defensin, beta 107A Application All Prestige Antibodies ® Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal -
HPA053160-100UL
Anti-DEFB115 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen defensin, beta 115 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA047430-100UL
Anti-DEFB116 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen defensin, beta 116 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA042634-100UL
Anti-DEFB118 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen defensin, beta 118 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA043059-100UL
Anti-DEFB119 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen defensin, beta 119 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA051046-100UL
Anti-DEFB124 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen defensin, beta 124 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA043095-100UL
Anti-DEFB125 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen defensin, beta 125 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA014581-100UL
Anti-DEFB129 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to defensin beta 129 Sequence CCVGPKVVKLIKNYLQYGTPNVLNEDVQEMLKPAKNSSAVIQRKHILSVLPQIKSTSFFANTNFVIIPNATPMNSATISTMTPGQITYTATSTKSNTKESRDSATASPPPAPPPPNILPTPSLEL Application All Prestige Antibodies Powered by -
HPA046399-100UL
Anti-DEFB132 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen defensin, beta 132 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA068255-100UL
Anti-DEFB136 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to defensin beta 136 Sequence GMFGNDGVKVRTCTSQKAVCFFGCPPGYRWIAFCHNILSCCKNMTRFQPPQAKDP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
AB3478
Anti-Defensin beta3 Antibody (C15-1316-073)
Price: $759.43List Price: $843.81Beta Defensin-3 is a novel 5 kDa nonhemolytic antimicrobial protein peptide which may be important in the innate epithelial defense of infections by various microorganisms seen in skin and lung (such as cystic fibrosis). Specificity Recognizes the -
HPA054955-100UL
Anti-DENND2C antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen DENN/MADD domain containing 2C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in