Immunomodulating drugs

Forkhead family transcription factor (FKHRL1), also known as FOX3a, is a member of the forkhead transcription factor superfamily. In FKHRL1 (FOX3a), there are three PKB phosphorylation consensus sites, Thr 32 , Ser 253 , and Ser 315 .

Fukutin (FKTN) is a glycosyltransferase localized to the Golgi apparatus. The gene encoding this protein is located on chromosome 9q31-33.

Immunogen filaggrin recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies &#174 are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for

Immunogen filaggrin recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies &#174 are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for

Immunogen Protein flightless-1 homolog recombinant protein epitope signature tag (PrEST) Sequence KDSAQDDQAKQVLKGMSDVAQEKNKKQEESADARAPSGKVRRWDQGLEKPRLDYSEFFTEDVGQLPGLTIWQIENFVPVLVEEAFHGKFYEADCYIVLKTFLDDSGSLNWEIYYWIGGEATLDKKACSAI Application All

Immunogen Protein flightless-1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

FLNB (filamin B, &#946) is a 280kDa cytoskeletal protein consists of the NH2-terminal actin-binding domain, a backbone of 24 tandem repeats, and two hinge" regions. It belongs to the filamin family."

FLNB (filamin B, &#946) is a 280kDa cytoskeletal protein belonging to the filamin family. It consists of NH2-terminal actin-binding domain, a backbone of 24 tandem repeats, and two hinge" regions."

Filamin-C (FLN-C) or filamin-2 (FLN2) is a protein encoded by the FLNC gene in humans and is mapped to chromosome 7q32.1.

Immunogen filamin C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Flotillin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Flotillin-2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most