Immunomodulating drugs

Immunogen frequently rearranged in advanced T-cell lymphomas 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Fibroblast growth factor receptor substrate 2 (FRS2), also known as suc-1 associated neurotrophic factor target protein (SNT) exist in two structurally similar forms namely, FRS2a (SNT-1) and FRS-2b (SNT-2). FRS2 is characterized with a consensus

Immunogen fibroblast growth factor receptor substrate 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen fibroblast growth factor receptor substrate 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen follicle stimulating hormone, beta polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen microRNA 198 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Recombinant protein corresponding to follistatin like 1 Sequence KCALEDETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQETAEKTK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen follistatin-like 3 (secreted glycoprotein) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ferritin, light polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen fat mass and obesity associated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen chromosome 10 open reading frame 125 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Frataxin (FXN) is a mitochondrial protein, located on human chromosome 9. It is produced in the cytoplasm and migrated to the mitochondria through a signal peptide.