Immunomodulating drugs

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) is a multifunctional protein, that is located on human chromosome 12p13. It is well-known as a glycolytic enzyme.

Immunogen glyceraldehyde-3-phosphate dehydrogenase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Anti-GAPDH, mouse monoclonal, clone 6C5, recognizes ~146 kDa GAPDH protein under non-reducing conditions &amp 36 kDa monomers under reducing conditions. It is validated for use in ELISA, WB, and IHC.

Immunogen GTPase activating protein and VPS9 domains 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Gapvd1 (GTPase activating protein and VPS9 domains 1) is an endosome-associated protein and an activator of Rab. It is also known as RAP6 (Rab5-activating protein 6), Gapex-5 (GTPase activating protein) or RME-6 (receptor-mediated endocytosis

Immunogen GRB2 associated regulator of MAPK1 subtype 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen GRB2 associated regulator of MAPK1 subtype 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen GRB2 associated regulator of MAPK1 subtype 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

GARNL3 (GTPase activating Rap/RanGAP domain-like 3) is located on chromosome 9q33.3.

Immunogen GTPase activating Rap/RanGAP domain-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to GTPase activating Rap/RanGAP domain like 3 Sequence ISSDADGAIQRAGRFRVENGSSDENATALPGTWRRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSIL Application All Prestige

GATA4 (GATA binding factor-4) is a member of the GATA family of transcription factors. GATA4 is involved in embryogenesis and in myocardial differentiation and function and is associated with heart septal defects.