Immunomodulating drugs

Immunogen Synthetic peptide directed towards the middle region of human GLYATL2 Application Anti-GLYATL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0&#956g/ml.

Immunogen glycine-N-acyltransferase-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen glycine-N-acyltransferase-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Specificity Glycine. The antibody has been calibrated against a spectrum of antigens to assure hapten selectivity and proper affinity.

Specificity Glycine The cross-reactivities were determined using either ELISA or RIA techniques, at concentration/unconjugated or conjugated amino acid concentration at half displacement. Compound Cross-reactivity Glycine-G-BSA 1 Beta Alanine-G-BSA

Specificity Recognizes glycine receptor alpha1. Shows cross reactivity to glycine receptor alpha2.

Immunogen Glycerate kinase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

GNAI2 (guanine nucleotide binding protein (G protein), &#945 inhibiting activity polypeptide 2) gene encodes an &#945 subunit of guanine nucleotide binding proteins (G proteins). It is a member of the G protein signal transduction family that

Immunogen Immunogen Sequence: GI # 5729850 , sequence 345-353 Synthetic peptide sequence of guanine nucleotide binding protein (G protein), &#945 inhibiting activity polypeptide 3. Application Anti-GNAI3 antibody produced in chicken is suitable

Immunogen Recombinant protein corresponding to G protein subunit alpha L Sequence NQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFER Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,