Immunomodulating drugs

Immunogen gasdermin D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Synthetic peptide directed towards the N terminal region of human GSDML Biochem/physiol Actions GSDML belongs to the gasdermin family.GSDML may play a role as secretory or metabolic product involved in secretory pathway.

Immunogen germ cell associated 2 (haspin) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Gsh2 is a homedomain transcription factor that is critically involved in neurogenesis during embryonic development. It is involved in the development of the ventral forebrain structures from lateral ganglionic eminence (LGE) neuronal progenitor

GSH2 is a homeobox protein that regulates dorsoventral patterning in mammalian telencephalon. Rabbit Anti-GSH2 antibody recognizes rat, human, mouse, and canine GSH2.

Immunogen Synthetic peptide directed towards the C terminal region of human GSH2 Biochem/physiol Actions homeobox protein GSH-2 Sequence Synthetic peptide located within the following region: LLELEREFSSNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKG

Immunogen chromosome 14 open reading frame 129 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Synthetic peptide directed towards the C terminal region of human GSN Application Anti-GSN antibody produced in rabbit is suitable for western blotting at a concentration of 1&#956g/mL. Biochem/physiol Actions GSN gene encodes a

Immunogen gelsolin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human

Immunogen glutathione S-transferase, C-terminal domain containing recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Recombinant protein corresponding to glutathione S-transferase, C-terminal domain containing. Sequence SEKLVEFPLLASWYQRIQEVPGVKTAASKCGIQFLHLPKLLTTSTEQHPNLCEVPGVEEQSDPLFIGGPRPTMAKLMEKGIEVMFSPHPCPTWTLDW Application All Prestige Antibodies

Immunogen Immunogen Sequence: GI # 4758484 , sequence 1-241 Recombinant glutathione-S-transferase omega 1 Physical form Solution in phosphate buffered saline containing 0.02% sodium azide.