Immunomodulating drugs

Immunogen H2B histone family, member W, testis-specific recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Specificity HA (Influenza Hemaglutinin) epitope Immunogen Synthetic peptide YPYDVPDYA from influenza hemaglutinin (HA) epitope. Application Research Category Epitope Tags &amp General Use Research Sub Category Epitope Tags This Anti-HA Epitope Tag

The HA tag is derived from an epitope of the influenza hemagglutinin protein, which has been extensively used as a general fusion tag in expression vectors. It has antigenic sites, cleavage sites, receptor binding sites, and fusion peptides

Chicken polyclonal anti-HADHSC antibody reacts with mouse, rat, human L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain, EC 1.1.

U4/U6.U5 tri-snRNP-associated protein 1 (UniProt O43290 also known as Allergen Hom s 1, HAF, hSART-1, hSnu66, Hypoxia-associated factor, SART-1, SNU66 homolog, Squamous cell carcinoma antigen recognized by T-cells 1, U4/U6.

Immunogen Immunogen Sequence: GI # 4885389 , sequence 110-260 Recombinant hydroxyacyl glutathione hydrolase Physical form Solution in phosphate buffered saline containing 0.02% sodium azide.

Immunogen hydroxyacylglutathione hydrolase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen hydroxyacylglutathione hydrolase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to hydroxyacylglutathione hydrolase-like Sequence KVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Hemoglobin subunit &#914 (HBB) is a 108 amino acid protein and is a member of the histone-like protein family. HBB gene spanning 327bp long on genomic DNA, is mapped to human chromosome 11p15.

Immunogen hemoglobin, theta 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen HBS1-like translational GTPase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in