-
Add to Cart The item has been addedHPA029729-100ULAnti-HBS1L antibody produced in rabbit (C15-1452-390)
Price: $879.43List Price: $977.14Immunogen HBS1-like translational GTPase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedAV42231-100ULAnti-HBZ antibody produced in rabbit (C15-1341-381)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human HBZ Biochem/physiol Actions Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is -
Add to Cart The item has been addedHPA063268-100ULANTI-HBZ ANTIBODY PRODUCED IN RABBIT (C15-1464-321)
Price: $977.14List Price: $1,085.71Immunogen hemoglobin subunit zeta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA064073-100ULANTI-HBZ ANTIBODY PRODUCED IN RABBIT (C15-1464-557)
Price: $977.14List Price: $1,085.71Immunogen hemoglobin subunit zeta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA071726-100ULAnti-HBZ antibody produced in rabbit (C15-1466-088)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to hemoglobin subunit zeta Sequence TIIVSMWAKISTQADTIGTETLERLFLSHPQTKTY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA002946-100ULAnti-HCCS antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Cytochrome c-type heme lyase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA064801-100ULANTI-HCRT ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen hypocretin neuropeptide precursor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA040697-100ULAnti-HDHD2 antibody produced in rabbit (C15-1456-308)
Price: $928.29List Price: $1,031.43Immunogen haloacid dehalogenase-like hydrolase domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA059818-100ULAnti-HDHD2 antibody produced in rabbit (C15-1463-379)
Price: $928.29List Price: $1,031.43Immunogen haloacid dehalogenase-like hydrolase domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA020427-100ULAnti-HDHD3 antibody produced in rabbit (C15-1449-596)
Price: $879.43List Price: $977.14Haloacid dehalogenase-like hydrolase domain-containing protein 3 (HDHD3) is a flavin mononucleotide (FMN) phosphatase belonging to the haloacid dehalogenase superfamily. Immunogen Haloacid dehalogenase-like hydrolase domain-containing protein 3 -
Add to Cart The item has been addedHPA024158-100ULAnti-HDHD3 antibody produced in rabbit (C15-1450-653)
Price: $879.43List Price: $977.14Immunogen Haloacid dehalogenase-like hydrolase domain-containing protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA024585-100ULAnti-HDHD3 antibody produced in rabbit (C15-1450-809)
Price: $879.43List Price: $977.14Immunogen Haloacid dehalogenase-like hydrolase domain-containing protein 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas
