-
Add to Cart The item has been added386040-50UGAnti-Hsp90 Mouse mAb (AC88) (C15-1303-154)
Price: $721.46List Price: $801.62Protein G purified mouse monoclonal antibody. Recognizes the ~90 kDa Hsp90 protein. -
Add to Cart The item has been addedHPA027639-100ULAnti-HSPB7 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen heat shock 27kDa protein family, member 7 (cardiovascular) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA004931-100ULAnti-HTR1E antibody produced in rabbit
Price: $879.43List Price: $977.14HTR1E (5-hydroxytryptamine (serotonin) receptor 1E) is specifically expressed in the human frontal cortex and hippocampus. Immunogen 5-hydroxytryptamine receptor 1E recombinant protein epitope signature tag (PrEST) Application All Prestige -
Add to Cart The item has been addedHPA073617-100ULAnti-HTR7 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to 5-hydroxytryptamine receptor 7 Sequence NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedAB5971Anti-HuD Antibody (C15-1316-408)
Price: $759.43List Price: $843.81Specificity Recognizes HuD. The molecular weight of the protein is 41,766 Daltons. -
Add to Cart The item has been addedCWA-1104-25ULANTI-HUMAN ?-TUBULIN III (TU-20) COLORWHEEL DYE-READY MAB
Price: $306.73List Price: $340.82ColorWheelColorWheel ® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any ColorWheelColorWheel ® antibody with any ColorWheelColorWheel ® dye, -
Add to Cart The item has been addedCWA-1045-25ULANTI-HUMAN CD10 (MEM-78) COLORWHEEL DYE-READY MAB
Price: $306.73List Price: $340.82ColorWheel ® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any ColorWheel ® antibody with any ColorWheel ® dye, researchers can quickly and -
Add to Cart The item has been addedCWA-1065-25ULANTI-HUMAN CD103 (BER-ACT8) COLORWHEEL DYE-READY MAB
Price: $306.73List Price: $340.82ColorWheel ® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any ColorWheel ® antibody with any ColorWheel ® dye, researchers can quickly and -
Add to Cart The item has been addedCWA-1060-25ULANTI-HUMAN CD105 (SN6) COLORWHEEL DYE-READY MAB
Price: $306.73List Price: $340.82ColorWheel ® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any ColorWheel ® antibody with any ColorWheel ® dye, researchers can quickly and -
Add to Cart The item has been addedCWA-1056-25ULANTI-HUMAN CD11C (3.9) COLORWHEEL DYE-READY MAB
Price: $306.73List Price: $340.82ColorWheel ® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any ColorWheel ® antibody with any ColorWheel ® dye, researchers can quickly and -
Add to Cart The item has been addedCWA-1044-25ULANTI-HUMAN CD138 (MI15) COLORWHEEL DYE-READY MAB
Price: $306.73List Price: $340.82ColorWheel ® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any ColorWheel ® antibody with any ColorWheel ® dye, researchers can quickly and -
Add to Cart The item has been addedCWA-1001-25ULANTI-HUMAN CD15 (28) COLORWHEEL DYE-READY MAB
Price: $306.73List Price: $340.82ColorWheel ® technology is a novel and proprietary method of creating your own antibody and dye combinations for use in flow cytometry. By incubating any ColorWheel ® antibody with any ColorWheel ® dye, researchers can quickly and
