Immunomodulating drugs

Specificity Apoptosis is related to many diseases and induced by a family of cell death receptors and their ligands. Cell death signals are transduced by death domain containing adapter molecules and members of the caspase family of proteases.

ICAM5 (intercellular adhesion molecule 5), also known as telencephalin, is a member of the ICAM family, which has a molecular weight of 130kDa. It is expressed on mammalian telencephalon neurons and is a type I transmembrane glycoprotein.

ICAM5 (intercellular adhesion molecule 5), also called telencephalin, is a neuronal cell adhesion molecule belonging to the ICAM family. This gene is localized to human chromosome 19p13.

Immunogen Recombinant protein corresponding to inducible T-cell costimulator ligand Sequence KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Isocitrate dehydrogenase [NAD] subunit &#947, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Isocitrate dehydrogenase 3 is an enzyme with three subunits (&#945, &#946 and &#947). In mammals, three subclasses of isocitrate dehydrogenases have been identified: mitochondrial NAD+ (nicotinamide adenine dinucleotide) dependent, mitochondrial

Specificity IDO [Indoleamine 2,3-dioxygenase], mouse. Immunogen Recombinant mouse IDO.

Purified mouse monoclonal antibody generated by immunizing SJL mice with the specified immunogen and fusing splenocytes with FO mouse myeloma cells (see application references). Recognizes the ~130 kDa &#945 and the ~90 kDa &#946 subunits of

This Anti-IGF-IR (Ab-1) Mouse mAb (&#945IR3) is validated for use in IF, IP, Neutralization Studies, Paraffin Sections, Immunoblotting for the detection of IGF-IR (Ab-1). Application Immunofluorescence (1-5 &#181g/ml) Immunoprecipitation (1

Immunogen immunoglobulin lambda-like polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen immunoglobulin lambda-like polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen immunoglobulin superfamily member 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive