Immunomodulating drugs

Immunoglobulin superfamily member 10 precursor (IGSF10) is a 2597 amino acid protein. It contains a signal peptide at the amino-terminal region, leucine-rich repeats (LRRs) and immunoglobulin-like repeats.

Immunogen immunoglobulin superfamily, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen immunoglobulin superfamily, member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Zinc finger protein Aiolos recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen IKAROS family zinc finger 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to interleukin 20 receptor subunit beta Sequence QFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen ilvB (bacterial acetolactate synthase)-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to inner mitochondrial membrane peptidase subunit 1 Sequence GGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen IMP3, U3 small nucleolar ribonucleoprotein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen IMP3, U3 small nucleolar ribonucleoprotein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen inositol(myo)-1(or 4)-monophosphatase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

IMPAD1 (inositol monophosphatase domain containing 1) is a nucleotide phosphatase which is localized to Golgi, and hence, is also called Golgi-resident PAP phosphatase (gPAPP). This gene is localized to human chromosome 8.