Immunomodulating drugs

Immunogen importin 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Importin-7 (IPO7) localizes in the cytoplasm and the nucleus. Immunogen Importin-7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Importin 7 (imo7/imp7) is a nucleocytoplasmic transport protein, that belongs to the imp&#946 family of nuclear transport receptors (NTRs). It is located on human chromosome 11p15.

Immunogen Recombinant protein corresponding to IQ motif containing G Sequence LDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQA Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Synthetic peptide directed towards the N terminal region of human IRF4 Biochem/physiol Actions IFN regulatory factor (IRF)-4 is a lymphoid/myeloid-restricted member of the IRF transcription factor family that plays an essential role in

Interferon regulatory factor-4 (IRF4), a transcription factor, is essential for Th (T helper)-2 effector cell differentiation. It belongs to the interferon (IFN) regulatory factor (IRF) transcription factor family.

Immunogen Interferon regulatory factor 4 recombinant protein epitope signature tag (PrEST) Sequence ALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLC

Immunogen Immunogen Sequence: GI # 4504747 , sequence 1015-1051 Recombinant integrin &#945 3 isoform a Application Anti-ITGA3 antibody produced in chicken is suitable for western blotting analysis at a dilution of 1:500, for tissue or cell

Immunogen involucrin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

The gene IZUMO1 (izumo sperm-egg fusion 1) is mapped to human chromosome 19q13.33.

Immunogen IZUMO family member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen IZUMO family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by