Immunomodulating drugs

Organelle transport is facilitated by molecular motors, such as kinesin and dynein, which interact with microtubules to transport cargo in an ATP-dependent manner. The shuttling of organelles is also dependent on kinectin, a transmembrane ER

Immunogen Recombinant protein corresponding to kin of IRRE like 2 (Drosophila) Sequence EVTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADASFL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen kin of IRRE like 3 (Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen kinesin light chain 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen kinesin light chain 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen kinesin light chain 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen kinesin light chain 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen kinesin light chain 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen kinesin light chain 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Kruppel-like factor 5 (intestinal) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

KLF7 (Kruppel-like factor 7) gene is mapped in human chromosome 2q33.3.

Immunogen Synthetic peptide directed towards the N terminal region of human KLHDC1 Biochem/physiol Actions KLHDC1 contains 6 Kelch repeats. KLHDC1 and KLHDC2 have differential localization and activity in cultured mammalian cells.