Immunomodulating drugs

Immunogen O-6-methylguanine-DNA methyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to O-6-methylguanine-DNA methyltransferase Sequence KDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPE Application All Prestige Antibodies Powered by Atlas Antibodies are developed

Hypoxia up-regulated mitochondrial movement regulator (HUMMR), a novel mitochondria protein, is expressed in neurons and is markedly induced by hypoxia-inducible factor 1 &#945 (HIF-1&#945). HUMMR interacts with Miro-1 and Miro-2, mitochondrial

Immunogen melanoma inhibitory activity recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen microtubule associated monooxygenase, calponin and LIM domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

The previously assigned protein identifier Q6ZW33 has been merged into O94851. Full details can be found on the UniProt database.

The previously assigned protein identifier Q6ZW33 has been merged into O94851. Full details can be found on the UniProt database.

MICU1 (mitochondrial calcium uniporter regulator 1) is located on human chromosome 10. It codes for a modulator of mitochondrial Ca 2+ uptake.

CBARA1 is a mitochondrial inner membrane protein that regulates calcium uptake. This membrane protein has EF-domains which may function as calcium sensors.

The gene MICU3 (mitochondrial calcium uptake family member 3) is mapped to human chromosome 8p22. The encoded protein has a mitochondrial targeting sequence and two canonical Ca 2+ -binding EF hands.

Immunogen mesoderm induction early response 1, family member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Macrophage migration inhibitory factor recombinant protein epitope signature tag (PrEST) Application Anti-MIF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each