-
Add to Cart The item has been addedHPA056091-100ULAnti-MPC2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen mitochondrial pyruvate carrier 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA014845-100ULAnti-MPDU1 antibody produced in rabbit
Price: $879.43List Price: $977.14MPDU1 (mannose-P-dolichol utilization defect 1) is a human homolog of Lec35, which is a hamster protein. This gene is localized to human chromosome 17p12-13. -
Add to Cart The item has been addedHPA020255-100ULAnti-MPDZ antibody produced in rabbit (C15-1449-551)
Price: $879.43List Price: $977.14Multiple PDZ domain protein (MPDZ) is a 220kDa protein expressed in the borders of epithelial cells and tight junctions. It possesses 13 PDZ (PSD95, Dlg1 and zo-1) binding domains. -
Add to Cart The item has been addedHPA026686-100ULAnti-MPDZ antibody produced in rabbit (C15-1451-156)
Price: $879.43List Price: $977.14Immunogen Multiple PDZ domain protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA046801-100ULAnti-MPEG1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen macrophage expressed 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA026948-100ULAnti-MPHOSPH6 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen M-phase phosphoprotein 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA058457-100ULAnti-MPLKIP antibody produced in rabbit (C15-1462-955)
Price: $928.29List Price: $1,031.43Immunogen M-phase specific PLK1 interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA065463-100ULAnti-MPLKIP antibody produced in rabbit (C15-1464-892)
Price: $928.29List Price: $1,031.43Immunogen M-phase specific PLK1 interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA021147-100ULAnti-MPO antibody produced in rabbit (C15-1449-764)
Price: $879.43List Price: $977.14The gene MPO (myeloperoxidase) is mapped to human chromosome 17q23.1. -
Add to Cart The item has been addedHPA061464-100ULAnti-MPO antibody produced in rabbit (C15-1463-811)
Price: $928.29List Price: $1,031.43Immunogen myeloperoxidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA000993-100ULAnti-MPP5 antibody produced in rabbit (C15-1445-129)
Price: $879.43List Price: $977.14The gene MPP5 (membrane protein, palmitoylated 5) is mapped to human chromosome 14q23.3. -
Add to Cart The item has been addedHPA063890-100ULAnti-MPP5 antibody produced in rabbit (C15-1464-509)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to membrane palmitoylated protein 5 Sequence INSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAI Application All Prestige Antibodies Powered by Atlas Antibodies are developed and
