-
HPA040241-100UL
Anti-MRPL48 antibody produced in rabbit (C15-1456-119)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L48 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA040864-100UL
Anti-MRPL48 antibody produced in rabbit (C15-1456-400)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L48 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA046778-100UL
Anti-MRPL49 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L49 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA022925-100UL
Anti-MRPL50 antibody produced in rabbit (C15-1450-177)
Price: $879.43List Price: $977.14MRPL50 (mitochondrial ribosomal protein L50) is a component of the large subunit of human mitochondrial ribosomes. Immunogen 39S ribosomal protein L50, mitochondrial recombinant protein epitope signature tag (PrEST) Application All Prestige -
HPA056854-100UL
Anti-MRPL50 antibody produced in rabbit (C15-1462-476)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to mitochondrial ribosomal protein L50 Sequence LGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA039923-100UL
Anti-MRPL51 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L51 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA012319-100UL
Anti-MRPL52 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen 39S ribosomal protein L52, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA042117-100UL
Anti-MRPL54 antibody produced in rabbit (C15-1457-072)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L54 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA046767-100UL
Anti-MRPL54 antibody produced in rabbit (C15-1458-986)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L54 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA027641-100UL
Anti-MRPL55 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen mitochondrial ribosomal protein L55 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA039779-100UL
Anti-MRPL57 antibody produced in rabbit (C15-1455-899)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L57 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA059370-100UL
Anti-MRPL57 antibody produced in rabbit (C15-1463-233)
Price: $928.29List Price: $1,031.43Immunogen mitochondrial ribosomal protein L57 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization