-
Add to Cart The item has been addedHPA054898-100ULAnti-NAIF1 antibody produced in rabbit (C15-1461-824)
Price: $928.29List Price: $1,031.43Immunogen nuclear apoptosis inducing factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA064931-100ULAnti-NAIF1 antibody produced in rabbit (C15-1464-772)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to nuclear apoptosis inducing factor 1 Sequence EQQNDLLQMIRRSQEVQACAQERQAQAMEGTQAALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA042438-100ULAnti-NAIP antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen NLR family, apoptosis inhibitory protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA060371-100ULAnti-NANOGNB antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen NANOG neighbor homeobox Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA028861-100ULAnti-NAP1L1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen nucleosome assembly protein 1-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA054050-100ULAnti-NAP1L2 antibody produced in rabbit (C15-1461-545)
Price: $928.29List Price: $1,031.43Immunogen nucleosome assembly protein 1-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA057065-100ULAnti-NAP1L2 antibody produced in rabbit (C15-1462-542)
Price: $928.29List Price: $1,031.43Immunogen nucleosome assembly protein 1-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA058227-100ULAnti-NAP1L5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen nucleosome assembly protein 1-like 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA044957-100ULAnti-NAP1L6 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen nucleosome assembly protein 1-like 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA046149-100ULAnti-NAPA antibody produced in rabbit (C15-1458-747)
Price: $928.29List Price: $1,031.43Immunogen N-ethylmaleimide-sensitive factor attachment protein, alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA050196-100ULAnti-NAPA antibody produced in rabbit (C15-1460-218)
Price: $928.29List Price: $1,031.43Immunogen N-ethylmaleimide-sensitive factor attachment protein, alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA008208-100ULAnti-NAPG antibody produced in rabbit (C15-1447-078)
Price: $879.43List Price: $977.14The gene encoding N-ethylmaleimide-sensitive factor attachment protein gamma (NAPG) is present on chromosome 18p11. Immunogen Gamma-soluble NSF attachment protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies
