Immunomodulating drugs

Immunogen Recombinant protein corresponding to nei like DNA glycosylase 2 Sequence DPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen Recombinant protein corresponding to nei like DNA glycosylase 2 Sequence IHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen nei-like DNA glycosylase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen negative elongation factor complex member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen negative elongation factor complex member A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Negative elongation factor complex member B (NELFB) is part of the negative elongation factor (NELF) complex. Immunogen Negative elongation factor B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by

Immunogen Negative elongation factor E recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen negative elongation factor complex member E Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen NEL-like 1 (chicken) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Nuclear export mediator factor (NEMF) encodes a protein which exhibits the tumor suppression property. It plays a vital role in mediating nuclear export.

The gene TMEM194A (transmembrane protein 194A), also referred to as NEMP1 (nuclear envelope integral membrane protein 1), is an inner nuclear membrane protein 1. The encoded protein has two regions A and B with evolutionarily conserved sequences in

NENF is a secreted protein that is expressed in neurons but not glial cells of the brain. This protein has neurotrophic activity in primary cultured mouse neurons but not mitogenic activity in primary cultured mouse astrocytes.