-
Add to Cart The item has been addedHPA069278-100ULAnti-NLGN2 antibody produced in rabbit (C15-1465-636)
Price: $928.29List Price: $1,031.43Immunogen neuroligin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA003183-100ULAnti-NLGN3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Neuroligin-3 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA001651-100ULAnti-NLGN4X antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Neuroligin-4, X-linked precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA046402-100ULAnti-NLRP11 antibody produced in rabbit (C15-1458-840)
Price: $928.29List Price: $1,031.43Immunogen NLR family, pyrin domain containing 11 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA078027-100ULAnti-NLRP11 antibody produced in rabbit (C15-1467-131)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to NLR family pyrin domain containing 11 Sequence LRELHIFDNDLNGISERILSKALEHSSCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTSISLNMFSLLHDILHEPTCQISHLSLMKCDLRASE Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedABF23Anti-NLRP3 Antibody (C15-1317-302)
Price: $642.86List Price: $714.29NLRPs (Nucleotide-binding oligomerization domain, Leucine rich Repeat and Pyrin domain containing Proteins) are members of NLR (Nod-like receptors) protein family. NRLP genes are known to play important roles in both the mammalian reproductive -
Add to Cart The item has been addedHPA056271-100ULAnti-NLRP5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen NLR family, pyrin domain containing 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedABF29Anti-NLRP6 (NALP6) Antibody (C15-1317-305)
Price: $687.43List Price: $763.81NRLP6 (NALP6) (also known as PYRIN-containing Apaf-1-like protein 5 or PYPAF5) belongs to a family of proteins that play a critical role in apoptosis and in inflammatory signaling. Its expression is highly restricted to granulocytes and T-cells. -
Add to Cart The item has been addedHPA056989-100ULAnti-NLRP8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen NLR family, pyrin domain containing 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA035648-100ULAnti-NME5 antibody produced in rabbit (C15-1453-950)
Price: $928.29List Price: $1,031.43Immunogen NME/NM23 family member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA044555-100ULAnti-NME5 antibody produced in rabbit (C15-1458-185)
Price: $928.29List Price: $1,031.43Immunogen non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA058103-100ULANTI-NME5 ANTIBODY PRODUCED IN RABBIT (C15-1462-830)
Price: $977.14List Price: $1,085.71Immunogen NME/NM23 family member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
