Immunomodulating drugs

Immunogen phenazine biosynthesis-like protein domain containing recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Phenazine biosynthesis like protein domain containing (PBLD), also known as mitogen-activated protein kinase activator with WD40 repeats binding protein (MAWBP), is the only member of phenazine biosynthesis-like protein family. The encoded protein

Immunogen Protein polybromo-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen polybromo 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Pre-B-cell leukemia transcription factor 1 recombinant protein epitope signature tag (PrEST) Sequence PRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDEAQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGV Application All

Immunogen Pre-B-cell leukemia transcription factor 1 recombinant protein epitope signature tag (PrEST) Sequence

Immunogen pre-B-cell leukemia homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

PBX3 is a homeobox transcription factor that shares homology with the human proto-oncogene, PBX1. It is known to enhance the transcriptional functions of HOX proteins and can also modulate developmental genes.

Immunogen pre-B-cell leukemia homeobox 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to pre-B-cell leukemia homeobox 4. Sequence AEGVCRPEKRGRGGAVARAGTATPGGCPNDNSIE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen pre-B-cell leukemia transcription factor interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen protocadherin 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.