Immunomodulating drugs

Cyclic guanosine monophosphate (cGMP)-specific 3&#8242, 5&#8242-cyclic phosphodiesterase (PDE5A) is an 875-amino acid protein. It is expressed in platelets and smooth muscle cells.

PDE6 (phosphodiesterase 6A) is an &#945-subunit of rod cyclic guanosine monophosphate (cGMP) phosphodiesterase. It is a photoreceptor-specific heterotetrameric protein with two &#945 and &#946 catalytic subunits and two &#947-regulatory

Immunogen Recombinant protein corresponding to phosphodiesterase 6A Sequence EEVEKFLDSNIGFAKQYYNLHYRAKLISDLLGAKEAAVDFSNYHSPSSMEESEIIFDLLRDFQENLQTEKCIFNVM Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen phosphodiesterase 6D, cGMP-specific, rod, delta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen phosphodiesterase 6D, cGMP-specific, rod, delta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen Recombinant protein corresponding to phosphodiesterase 6H Sequence PRKGPPKFKQRQTRQFKSKPPKKGVKGFGDDIPGMEGLGTDITVICPWEAFSHLELHELA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen High affinity cAMP-specific 3&#8242,5&#8242-cyclic phosphodiesterase 7A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen cAMP-specific 3&#8242,5&#8242-cyclic phosphodiesterase 7B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

PDE9A is a ubiquitous protein belonging to the cyclic nucleotide phosphodiesterase family which regulate the signaling of cyclic nucleotides such as cGMP and cAMP. PDE9A has a higher affinity for cGMP.

Immunogen platelet-derived growth factor receptor, beta polypeptide recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen platelet-derived growth factor receptor-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

PDHA1 codes for the &#9451 subunit of the pyruvate dehydrogenase complex and modulates the activity of the complex. PDHA1 mutations have been implicated in pyruvate dehydrogenase deficiency.