Immunomodulating drugs

Immunogen paternally expressed 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Paternally expressed 10 (PEG10) is a monoallelic expressed gene. This imprinted gene is localized on human chromosome 7q21.

Paternally expressed 3 (PEG3, PW1) is involved in maternal genomic imprinting that is paternally expressed. Paternal expression of PEG3 regulates sexually experience effects on male behavior in mammals involving display of sexual behavior,

Immunogen PEG3 antisense RNA (non-protein coding) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen pellino E3 ubiquitin protein ligase family member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Synthetic peptide directed towards the N terminal region of human PELI3 Application Anti-PELI3 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1&#956g/mL. Biochem/physiol Actions The gene PELI3

Immunogen pelota homolog (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Xaa-Pro dipeptidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Recombinant protein corresponding to peptidase D Sequence DVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Specificity Recognizes human Per 1 (RIGUI). The immunogen shows no significant sequence homology with Per 2, Per 3, dPer or other known proteins.

PER2 is a component of the circadian clock mechanism which is essential for generating circadian rhythms. It is a negative element in the circadian transcriptional loop by Influencing clock function by interacting with other circadian regulatory

Specificity Recognizes mouse Per 2. The immunogen shows no significant sequence homology with Per 1 or Per 3.