Immunomodulating drugs

Immunogen phosphatase, orphan 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Recombinant protein corresponding to phosphoethanolamine/phosphocholine phosphatase Sequence RDLSAIYEAIPLSPGMSDLLQFVAKQGACFEVILISDANTFGVESSLRAAGHHSLFRRILSNPSGPDARGLLALRPF Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen phosphatase, orphan 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen phosphatase, orphan 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Cellular responses to a variety of extracellular signals occur through phosphorylation or dephosphorylation of intracellular proteins. Abnormal protein phosphorylation may be involved in the progression of numerous diseases, including many forms of

Paired mesoderm homeobox protein 2A (PHOX2A), also known as ARIX1 homeodomain protein (ARIX) and Paired-like homeobox 2A (PMX2A), along with the closely related PHOX2B, is a paired-homeodomain transcription factor that maintains the noradrenergic

PHYH (phytanoyl-CoA 2-hydroxylase) gene encodes a proprotein with an N-terminal PTS2 that is essential for its transport into peroxisomes via Pex7. This proprotein undergoes cleavage in the peroxisome to form the mature protein.

PHYH (Phytanoyl-CoA 2-hydroxylase) is an Fe(II) and 2OG (2-oxoglutarate) oxygenase consisting of a double-stranded &#946-helix core supported with three iron binding ligands. Immunogen Phytanoyl-CoA dioxygenase, peroxisomal precursor recombinant

Immunogen phytanoyl-CoA 2-hydroxylase interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen phytanoyl-CoA 2-hydroxylase interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen phytanoyl-CoA 2-hydroxylase interacting protein-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen alanine-glyoxylate aminotransferase 2-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a