Immunomodulating drugs

Immunogen piwi like RNA-mediated gene silencing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to piwi like RNA-mediated gene silencing 4 Sequence GRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGS Application All Prestige Antibodies Powered by Atlas

Immunogen piwi-like 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen piwi-like RNA-mediated gene silencing 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Praja ring finger ubiquitin ligase 2 (PJA2) is a RING (really interesting new gene) ligase, encoded by the gene mapped to human chromosome 5q21.3.

Immunogen praja ring finger 2, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen polycystic kidney disease (polycystin) and REJ homolog (sperm receptor for egg jelly homolog, sea urchin) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Pyruvate kinase isozymes M1/M2 (PKM2) is also called Cytosolic thyroid hormone-binding protein (CTHBP), Opa-interacting protein 3 (OIP-3), Pyruvate kinase 2/3, Pyruvate kinase muscle isozyme, Thyroid hormone-binding protein 1 (THBP1) and p58. PKM2

Pyruvate kinase isozymes M1/M2 (PKM2) is also called Cytosolic thyroid hormone-binding protein (CTHBP), Opa-interacting protein 3 (OIP-3), Pyruvate kinase 2/3, Pyruvate kinase muscle isozyme, Thyroid hormone-binding protein 1 (THBP1) and p58. PKM2

Immunogen protein kinase, membrane associated tyrosine/threonine 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen PBX/knotted 1 homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen PBX/knotted 1 homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the