Immunomodulating drugs

POF1B (premature ovarian failure, 1B) is an evolutionary novel gene that is expressed in polarised epithelial tissues, adherens and tight junctions in human jejunum. Structurally, it possess a large coiled-coil region in the C-terminal end of the

Immunogen protein O-fucosyltransferase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen pogo transposable element with KRAB domain recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen KTEL (Lys-Tyr-Glu-Leu) containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Recombinant protein corresponding to protein O-glucosyltransferase 1 Sequence KESGSKWKVFIDQINRSLENYEPCSSQNCSCYHGVIEEDLTPFRGGISRKMMAEVVRRKLGTHYQITKNRLYRENDCMFPSRCSGVEHFIL Application All Prestige Antibodies Powered by Atlas Antibodies are

POGZ is a zinc-finger protein known to interact with HP1&#945. Studies have reported that POGZ regulates the dissociation of Aurora B kinase from chromosomal arms during the M phase of the cell cycle.

Immunogen Pogo transposable element with ZNF domain recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Pogo transposable element with ZNF domain recombinant protein epitope signature tag (PrEST) Sequence

Immunogen DNA polymerase &#945 catalytic subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen polymerase (DNA directed), alpha 2 (70kD subunit) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen polymerase (DNA directed), beta Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen polymerase (DNA directed), delta 1, catalytic subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most