Immunomodulating drugs

Precerebellin is the precursor of the brain-specific hexadecapeptide cerebellin, a protein with substantial similarity to the globular region of the B chain of complement component C1q. Cerebellin exerts neuromodulatory functions by directly

Immunogen PRELI domain containing 3B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Specificity Presenilin 1 Immunogen Synthetic peptides from human Presenilin 1. Application Detect Presenilin 1 using this Anti-Presenilin 1 Antibody validated for use in ELISA &amp WB.

PRKD2 (protein kinase D 2) is a member of calcium/calmodulin-dependent protein kinase superfamily. Phorbol esters effectively activate PRKD2 protein by binding to its two N-terminal cysteine rich domains.

Immunogen protein kinase D2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Recombinant protein corresponding to prolactin releasing hormone Sequence RTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen prolactin releasing hormone receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Specificity ProDynorphin, rat. Immunogen Synthetic peptide from rat ProDynorphin.

Prohibitin is an inhibitor of DNA synthesis that is widely expressed across various tissues. Prohibitin influences proliferation, and may also have a role in regulating mitochondrial respiration activity and in aging.

Specificity Recognizes Prostacyclin Receptor. Immunogen Synthetic peptide from the N-terminal extracellular domain of human Prostacyclin Receptor.

Protein A purified rabbit polyclonal antibody. Recognizes the ~55 kDa (apparent MW) protein disulfide isomerase protein.

Immunogen protein Z, vitamin K-dependent plasma glycoprotein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive