-
HPA051499-100UL
Anti-RAD51AP1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to RAD51 associated protein 1 Sequence DLEVALALSVKELPTVTTNVQNSQDKSIEKHGSSKIETMNKSPHISNCSVASDYLDLDKITVEDDVGGVQGKRKAASK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA028957-100UL
Anti-RAD52 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen RAD52 homolog, DNA repair protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA028954-100UL
Anti-RAD54L antibody produced in rabbit (C15-1452-066)
Price: $879.43List Price: $977.14Immunogen RAD54-like (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA051537-100UL
Anti-RAD54L antibody produced in rabbit (C15-1460-705)
Price: $928.29List Price: $1,031.43Immunogen RAD54-like (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA039992-100UL
Anti-RAD54L2 antibody produced in rabbit (C15-1456-010)
Price: $928.29List Price: $1,031.43Immunogen RAD54-like 2 (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA077351-100UL
ANTI-RAD54L2 ANTIBODY PRODUCED IN RABBIT (C15-1467-022)
Price: $977.14List Price: $1,085.71Immunogen RAD54 like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA002640-100UL
Anti-RAF1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Raf-1 proto-oncogene, serine/threonine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA000851-100UL
ANTI-RALGAPA1 antibody produced in rabbit
Price: $879.43List Price: $977.14GTPase-activating Rap/Ran-GAP domain-like 1 is an enzyme encoded by the RALGAPA1 gene in humans and is mapped to chromosome band 14q13.2. -
HPA051454-100UL
Anti-RALGAPB antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Ral GTPase activating protein, beta subunit (non-catalytic) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
AV42415-100UL
Anti-RALGPS1 antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the middle region of human RALGPS1 Biochem/physiol Actions RALGPS1 contains 1 PH domain and 1 Ras-GEF domain. RALGPS1 may be involved in cytoskeletal organization. -
HPA027143-100UL
Anti-RALGPS2 antibody produced in rabbit (C15-1451-340)
Price: $879.43List Price: $977.14Immunogen Ral GEF with PH domain and SH3 binding motif 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA028328-100UL
Anti-RALGPS2 antibody produced in rabbit (C15-1451-785)
Price: $879.43List Price: $977.14Immunogen Ral GEF with PH domain and SH3 binding motif 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a